SCOP 1.75: Domain d1mmsa2: 1mms A:8-70

Lineage for d1mmsa2 (1mms A:8-70)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
   beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123

4. Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family)

5. Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
   Pfam PF03946

6. Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)

7. Species Thermotoga maritima [TaxId:2336] [54750] (6 PDB entries)

8. Domain d1mmsa2: 1mms A:8-70 [38766]
   Other proteins in same PDB: d1mmsa1, d1mmsb_
   protein/RNA complex; complexed with cd, mg, mmc; mutant

Details for d1mmsa2

PDB Entry: 1mms, 2.57 Å

PDB Description: crystal structure of the ribosomal protein l11-rna complex

PDB Compounds: (A:) protein (ribosomal protein l11)

SCOP Domain Sequences for d1mmsa2:

Sequence; same for both SEQRES and ATOM records:

>d1mmsa2 d.47.1.1 (A:8-70) Ribosomal protein L11, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fii

Timeline for d1mmsa2:

• d1mmsa2 first appeared (with stable ids) in SCOP 1.55
  
• d1mmsa2 appears in SCOP 1.73
  
• d1mmsa2 appears in SCOPe 2.01
  
• d1mmsa2 appears in the current release, SCOPe 2.08