Lineage for d1mmsa2 (1mms A:8-70)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946680Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 2946681Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 2946682Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 2946686Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 2946722Species Thermotoga maritima [TaxId:2336] [54750] (2 PDB entries)
  8. 2946723Domain d1mmsa2: 1mms A:8-70 [38766]
    Other proteins in same PDB: d1mmsa1, d1mmsb_
    protein/RNA complex; complexed with cd, mg, mmc

Details for d1mmsa2

PDB Entry: 1mms (more details), 2.57 Å

PDB Description: crystal structure of the ribosomal protein l11-rna complex
PDB Compounds: (A:) protein (ribosomal protein l11)

SCOPe Domain Sequences for d1mmsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmsa2 d.47.1.1 (A:8-70) Ribosomal protein L11, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fii

SCOPe Domain Coordinates for d1mmsa2:

Click to download the PDB-style file with coordinates for d1mmsa2.
(The format of our PDB-style files is described here.)

Timeline for d1mmsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mmsa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1mmsb_