![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
![]() | Family b.22.1.1: TNF-like [49843] (15 proteins) |
![]() | Protein automated matches [190204] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186956] (14 PDB entries) |
![]() | Domain d6z6ve_: 6z6v E: [387651] Other proteins in same PDB: d6z6va_, d6z6vd_, d6z6vg1, d6z6vg2, d6z6vh1, d6z6vh2 automated match to d2wnvb_ complexed with nag |
PDB Entry: 6z6v (more details), 2.19 Å
SCOPe Domain Sequences for d6z6ve_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6z6ve_ b.22.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega nsifsgfllfpdm
Timeline for d6z6ve_: