Lineage for d6z6ve_ (6z6v E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777555Protein automated matches [190204] (3 species)
    not a true protein
  7. 2777556Species Human (Homo sapiens) [TaxId:9606] [186956] (13 PDB entries)
  8. 2777567Domain d6z6ve_: 6z6v E: [387651]
    Other proteins in same PDB: d6z6va_, d6z6vd_, d6z6vg1, d6z6vg2, d6z6vh1, d6z6vh2
    automated match to d2wnvb_
    complexed with nag

Details for d6z6ve_

PDB Entry: 6z6v (more details), 2.19 Å

PDB Description: globular head of c1q in complex with the nanobody c1qnb75
PDB Compounds: (E:) complement c1q subcomponent subunit b

SCOPe Domain Sequences for d6z6ve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6z6ve_ b.22.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg
nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega
nsifsgfllfpdm

SCOPe Domain Coordinates for d6z6ve_:

Click to download the PDB-style file with coordinates for d6z6ve_.
(The format of our PDB-style files is described here.)

Timeline for d6z6ve_: