![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries) |
![]() | Domain d6z6vg1: 6z6v G:4-124 [387645] Other proteins in same PDB: d6z6va_, d6z6vb_, d6z6vc_, d6z6vd_, d6z6ve_, d6z6vf_, d6z6vg2, d6z6vh2 automated match to d4nc2b_ complexed with nag |
PDB Entry: 6z6v (more details), 2.19 Å
SCOPe Domain Sequences for d6z6vg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6z6vg1 b.1.1.0 (G:4-124) automated matches {Llama (Lama glama) [TaxId: 9844]} qlvetggglvqaggslrlscaasgrtfnndvmawfrqapgterefvalitagggthyads vkgrfvisrdndknmaylqmnslksedtaiyycgadenppgwpsrwssaydywgqgtqvt v
Timeline for d6z6vg1: