| Class b: All beta proteins [48724] (149 folds) |
| Fold b.129: AbrB/MazE/MraZ-like [89446] (1 superfamily) pseudobarrel; capped on both ends by alpha-helices |
Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families) ![]() members of this superfamily are known or predicted to have DNA-binding function |
| Family b.129.1.3: Transcription-state regulator AbrB, the N-terminal DNA recognition domain [54743] (1 protein) dimeric fold similar to MazE; the DNA-binding site is similar to the conserved surface site of MraZ |
| Protein Transcription-state regulator AbrB, the N-terminal DNA recognition domain [54744] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [54745] (1 PDB entry) |
| Domain d1ekta_: 1ekt A: [38764] |
PDB Entry: 1ekt (more details)
SCOP Domain Sequences for d1ekta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ekta_ b.129.1.3 (A:) Transcription-state regulator AbrB, the N-terminal DNA recognition domain {Bacillus subtilis}
mkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpnmt
Timeline for d1ekta_: