Details for d1ekta_

PDB Entry: 1ekt (more details)

PDB Description: solution structure of the n-terminal dna recognition domain of the bacillus subtilis transcription-state regulator abrb

SCOP Domain Sequences for d1ekta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ekta_ d.46.1.1 (A:) Transcription-state regulator AbrB, the N-terminal DNA recognition domain {Bacillus subtilis}
mkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpnmt

SCOP Domain Coordinates for d1ekta_:

Click to download the PDB-style file with coordinates for d1ekta_.
(The format of our PDB-style files is described here.)

Timeline for d1ekta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ektb_