Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries) |
Domain d6xxnd1: 6xxn D:6-126 [387630] Other proteins in same PDB: d6xxna2, d6xxnb2, d6xxnc2, d6xxnd2, d6xxne2, d6xxnf2, d6xxng2, d6xxnh2 automated match to d1mqkh_ complexed with so4 |
PDB Entry: 6xxn (more details), 2.65 Å
SCOPe Domain Sequences for d6xxnd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xxnd1 b.1.1.1 (D:6-126) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} esgggsvqaggslrlsctapgytdsnyymswfrqapgkerewvagvntgrgstsyadsvk grftisqdnakntmflqmnslkpedtaiyycavaachfcdslpktqdeyilwgqgtqvtv s
Timeline for d6xxnd1: