| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.45: ClpS-like [54735] (1 superfamily) beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta |
Superfamily d.45.1: ClpS-like [54736] (3 families) ![]() |
| Family d.45.1.1: Ribosomal protein L7/12, C-terminal domain [54737] (1 protein) automatically mapped to Pfam PF00542 |
| Protein Ribosomal protein L7/12, C-terminal domain [54738] (3 species) |
| Species Thermotoga maritima [TaxId:2336] [54740] (3 PDB entries) |
| Domain d1dd4b2: 1dd4 B:58-128 [38763] Other proteins in same PDB: d1dd4a1, d1dd4b1, d1dd4c_, d1dd4d_ complexed with tbr |
PDB Entry: 1dd4 (more details), 2.4 Å
SCOPe Domain Sequences for d1dd4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dd4b2 d.45.1.1 (B:58-128) Ribosomal protein L7/12, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
efdvvlksfgqnkiqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkk
leeagaevelk
Timeline for d1dd4b2:
View in 3DDomains from other chains: (mouse over for more information) d1dd4a1, d1dd4a2, d1dd4c_, d1dd4d_ |