Lineage for d1dd3a2 (1dd3 A:58-128)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722358Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 722359Superfamily d.45.1: ClpS-like [54736] (2 families) (S)
  5. 722360Family d.45.1.1: Ribosomal protein L7/12, C-terminal domain [54737] (1 protein)
  6. 722361Protein Ribosomal protein L7/12, C-terminal domain [54738] (2 species)
  7. 722374Species Thermotoga maritima [TaxId:2336] [54740] (3 PDB entries)
  8. 722375Domain d1dd3a2: 1dd3 A:58-128 [38760]
    Other proteins in same PDB: d1dd3a1, d1dd3b1, d1dd3c_, d1dd3d_

Details for d1dd3a2

PDB Entry: 1dd3 (more details), 2 Å

PDB Description: crystal structure of ribosomal protein l12 from thermotoga maritima
PDB Compounds: (A:) 50S ribosomal protein L7/L12

SCOP Domain Sequences for d1dd3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dd3a2 d.45.1.1 (A:58-128) Ribosomal protein L7/12, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
efdvvlksfgqnkiqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkk
leeagaevelk

SCOP Domain Coordinates for d1dd3a2:

Click to download the PDB-style file with coordinates for d1dd3a2.
(The format of our PDB-style files is described here.)

Timeline for d1dd3a2: