SCOPe 2.07: Domain d6sbuc1: 6sbu C:2-160

Lineage for d6sbuc1 (6sbu C:2-160)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (19 species)

7. Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (38 PDB entries)

8. Domain d6sbuc1: 6sbu C:2-160 [387589]
   Other proteins in same PDB: d6sbua2, d6sbub2, d6sbuc2, d6sbud2, d6sbue2, d6sbuf2, d6sbug2, d6sbuh2
   automated match to d4jnka1
   complexed with l5n, nai

Details for d6sbuc1

PDB Entry: 6sbu, 2.91 Å

PDB Description: x-ray structure of human ldha with an allosteric inhibitor (compound 3)

PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d6sbuc1:

Sequence, based on SEQRES records:

>d6sbuc1 c.2.1.5 (C:2-160) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

Sequence, based on observed residues (ATOM records):

>d6sbuc1 c.2.1.5 (C:2-160) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllktpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemmd
lqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfiipnv
vkyspnckllivsnpvdiltyvawkisgfpknrvig

Timeline for d6sbuc1:

• d6sbuc1 is new in SCOPe 2.07-stable
  
• d6sbuc1 appears in the current release, SCOPe 2.08