Lineage for d5rhha2 (5rhh A:482-617)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (156 species)
    not a true protein
  7. 2873174Species Zika virus [TaxId:64320] [317810] (28 PDB entries)
  8. 2873189Domain d5rhha2: 5rhh A:482-617 [387582]
    Other proteins in same PDB: d5rhha1
    automated match to d5y4za2
    complexed with edo, mpd, po4, uqj

Details for d5rhha2

PDB Entry: 5rhh (more details), 1.59 Å

PDB Description: pandda analysis group deposition -- crystal structure of zika virus ns3 helicase in complex with z1515654336
PDB Compounds: (A:) NS3 helicase

SCOPe Domain Sequences for d5rhha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5rhha2 c.37.1.0 (A:482-617) automated matches {Zika virus [TaxId: 64320]}
eghahwlearmlldniylqdgliaslyrpeadkvaaiegefklrteqrktfvelmkrgdl
pvwlayqvasagitytdrrwcfdgttnntimedsvpaevwtkygekrvlkprwmdarvcs
dhaalksfkefaagkr

SCOPe Domain Coordinates for d5rhha2:

Click to download the PDB-style file with coordinates for d5rhha2.
(The format of our PDB-style files is described here.)

Timeline for d5rhha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5rhha1