Lineage for d1qnnd2 (1qnn D:85-191)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31967Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
  4. 31968Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 31969Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 31970Protein Cambialistic superoxide dismutase [54732] (2 species)
  7. 31971Species Porphyromonas gingivalis [TaxId:837] [54734] (1 PDB entry)
  8. 31975Domain d1qnnd2: 1qnn D:85-191 [38758]
    Other proteins in same PDB: d1qnna1, d1qnnb1, d1qnnc1, d1qnnd1

Details for d1qnnd2

PDB Entry: 1qnn (more details), 1.8 Å

PDB Description: cambialistic superoxide dismutase from porphyromonas gingivalis

SCOP Domain Sequences for d1qnnd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnnd2 d.44.1.1 (D:85-191) Cambialistic superoxide dismutase {Porphyromonas gingivalis}
kggapkgklgeaidkqfgsfekfkeefntagttlfgsgwvwlasdangklsiekepnagn
pvrkglnpllgfdvwehayyltyqnrradhlkdlwsivdwdivesry

SCOP Domain Coordinates for d1qnnd2:

Click to download the PDB-style file with coordinates for d1qnnd2.
(The format of our PDB-style files is described here.)

Timeline for d1qnnd2: