Lineage for d5rhua1 (5rhu A:183-481)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.14: RNA helicase [52724] (7 proteins)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. Protein automated matches [226986] (8 species)
    not a true protein
  7. Species Zika virus [TaxId:64320] [317808] (28 PDB entries)
  8. Domain d5rhua1: 5rhu A:183-481 [387562]
    Other proteins in same PDB: d5rhua2
    automated match to d5jpsa1
    complexed with edo, mpd, po4, ur7

Details for d5rhua1

PDB Entry: 5rhu (more details), 1.61 Å

PDB Description: pandda analysis group deposition -- crystal structure of zika virus ns3 helicase in complex with z1703168683
PDB Compounds: (A:) NS3 helicase

SCOPe Domain Sequences for d5rhua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5rhua1 c.37.1.14 (A:183-481) automated matches {Zika virus [TaxId: 64320]}
mlkkkqltvldlhpgagktrrvlpeivreaikkrlrtvilaptrvvaaemeealrglpvr
ymttavnvthsgteivdlmchatftsrllqpirvpnynlnimdeahftdpssiaargyis
trvemgeaaaifmtatppgtrdafpdsnspimdtevevperawssgfdwvtdhsgktvwf
vpsvrngneiaacltkagkrviqlsrktfetefqktknqewdfvittdisemganfkadr
vidsrrclkpvildgervilagpmpvthasaaqrrgrigrnpnkpgdeymygggcaetd

SCOPe Domain Coordinates for d5rhua1 are not available.

Timeline for d5rhua1:

Domains from same chain:
(mouse over for more information)
d5rhua2