Lineage for d1bt8b2 (1bt8 B:87-201)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 132817Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
  4. 132818Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 132819Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 132820Protein Cambialistic superoxide dismutase [54732] (2 species)
  7. 132826Species Propionibacterium shermanii [TaxId:1752] [54733] (6 PDB entries)
  8. 132838Domain d1bt8b2: 1bt8 B:87-201 [38754]
    Other proteins in same PDB: d1bt8a1, d1bt8b1

Details for d1bt8b2

PDB Entry: 1bt8 (more details), 1.85 Å

PDB Description: p.shermanii sod(fe+3) ph 10.0

SCOP Domain Sequences for d1bt8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bt8b2 d.44.1.1 (B:87-201) Cambialistic superoxide dismutase {Propionibacterium shermanii}
saperptdelgaaideffgsfdnmkaqftaaatgiqgsgwaslvwdplgkrintlqfydh
qnnlpagsipllqldmwehafylqyknvkgdyvkswwnvvnwddvalrfsearva

SCOP Domain Coordinates for d1bt8b2:

Click to download the PDB-style file with coordinates for d1bt8b2.
(The format of our PDB-style files is described here.)

Timeline for d1bt8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bt8b1