Lineage for d1bt8b2 (1bt8 B:87-201)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946003Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2946004Protein Cambialistic superoxide dismutase [54732] (2 species)
    active with either fe or mn
  7. 2946018Species Propionibacterium shermanii [TaxId:1752] [54733] (6 PDB entries)
  8. 2946028Domain d1bt8b2: 1bt8 B:87-201 [38754]
    Other proteins in same PDB: d1bt8a1, d1bt8b1
    complexed with fe

Details for d1bt8b2

PDB Entry: 1bt8 (more details), 1.85 Å

PDB Description: p.shermanii sod(fe+3) ph 10.0
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d1bt8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bt8b2 d.44.1.1 (B:87-201) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]}
saperptdelgaaideffgsfdnmkaqftaaatgiqgsgwaslvwdplgkrintlqfydh
qnnlpagsipllqldmwehafylqyknvkgdyvkswwnvvnwddvalrfsearva

SCOPe Domain Coordinates for d1bt8b2:

Click to download the PDB-style file with coordinates for d1bt8b2.
(The format of our PDB-style files is described here.)

Timeline for d1bt8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bt8b1