Lineage for d1ar4b2 (1ar4 B:87-201)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. Protein Cambialistic superoxide dismutase [54732] (2 species)
    active with either fe or mn
  7. Species Propionibacterium shermanii [TaxId:1752] [54733] (6 PDB entries)
  8. Domain d1ar4b2: 1ar4 B:87-201 [38752]
    Other proteins in same PDB: d1ar4a1, d1ar4b1
    complexed with mn

Details for d1ar4b2

PDB Entry: 1ar4 (more details), 1.9 Å

PDB Description: x-ray structure analysis of the cambialistic superoxide dismutase from propionibacterium shermanii active with fe or mn
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d1ar4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ar4b2 d.44.1.1 (B:87-201) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]}
saperptdelgaaideffgsfdnmkaqftaaatgiqgsgwaslvwdplgkrintlqfydh
qnnlpagsipllqldmwehafylqyknvkgdyvkswwnvvnwddvalrfsearva

SCOPe Domain Coordinates for d1ar4b2 are not available.

Timeline for d1ar4b2:

Domains from same chain:
(mouse over for more information)
d1ar4b1
Domains from other chains:
(mouse over for more information)
d1ar4a1, d1ar4a2