Lineage for d5qz6a1 (5qz6 A:1836-2069)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886992Family c.55.3.14: Prp8 beta-finger domain-like [159638] (1 protein)
    automatically mapped to Pfam PF12134
  6. 2886993Protein Pre-mRNA splicing factor 8, Prp8 / Spp42 [159639] (4 species)
  7. 2887002Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [234880] (138 PDB entries)
  8. 2887004Domain d5qz6a1: 5qz6 A:1836-2069 [387505]
    Other proteins in same PDB: d5qz6a2, d5qz6b1, d5qz6b2
    automated match to d3e9la1

Details for d5qz6a1

PDB Entry: 5qz6 (more details), 1.32 Å

PDB Description: pandda analysis group deposition -- auto-refined data of aar2/rnaseh for ground state model 21
PDB Compounds: (A:) Pre-mRNA-splicing factor 8

SCOPe Domain Sequences for d5qz6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qz6a1 c.55.3.14 (A:1836-2069) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflkiih
tsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfpnia
irptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlllral
ktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynv

SCOPe Domain Coordinates for d5qz6a1:

Click to download the PDB-style file with coordinates for d5qz6a1.
(The format of our PDB-style files is described here.)

Timeline for d5qz6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5qz6a2