Lineage for d1ar5b2 (1ar5 B:87-201)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31967Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
  4. 31968Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 31969Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 31970Protein Cambialistic superoxide dismutase [54732] (2 species)
  7. 31976Species Propionibacterium shermanii [TaxId:1752] [54733] (6 PDB entries)
  8. 31984Domain d1ar5b2: 1ar5 B:87-201 [38750]
    Other proteins in same PDB: d1ar5a1, d1ar5b1

Details for d1ar5b2

PDB Entry: 1ar5 (more details), 1.6 Å

PDB Description: x-ray structure of the cambialistic superoxide dismutase from propionibacterium shermanii active with fe or mn

SCOP Domain Sequences for d1ar5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ar5b2 d.44.1.1 (B:87-201) Cambialistic superoxide dismutase {Propionibacterium shermanii}
saperptdelgaaideffgsfdnmkaqftaaatgiqgsgwaslvwdplgkrintlqfydh
qnnlpagsipllqldmwehafylqyknvkgdyvkswwnvvnwddvalrfsearva

SCOP Domain Coordinates for d1ar5b2:

Click to download the PDB-style file with coordinates for d1ar5b2.
(The format of our PDB-style files is described here.)

Timeline for d1ar5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ar5b1