SCOPe 2.08: Domain d5rhma1: 5rhm A:183-481

Lineage for d5rhma1 (5rhm A:183-481)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (7 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein automated matches [226986] (8 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [317808] (28 PDB entries)

8. Domain d5rhma1: 5rhm A:183-481 [387495]
   Other proteins in same PDB: d5rhma2
   automated match to d5jpsa1
   complexed with edo, mpd, po4, uqs

Details for d5rhma1

PDB Entry: 5rhm, 1.68 Å

PDB Description: pandda analysis group deposition -- crystal structure of zika virus ns3 helicase in complex with z1454310449

PDB Compounds: (A:) NS3 helicase

SCOPe Domain Sequences for d5rhma1:

Sequence; same for both SEQRES and ATOM records:

>d5rhma1 c.37.1.14 (A:183-481) automated matches {Zika virus [TaxId: 64320]}
mlkkkqltvldlhpgagktrrvlpeivreaikkrlrtvilaptrvvaaemeealrglpvr
ymttavnvthsgteivdlmchatftsrllqpirvpnynlnimdeahftdpssiaargyis
trvemgeaaaifmtatppgtrdafpdsnspimdtevevperawssgfdwvtdhsgktvwf
vpsvrngneiaacltkagkrviqlsrktfetefqktknqewdfvittdisemganfkadr
vidsrrclkpvildgervilagpmpvthasaaqrrgrigrnpnkpgdeymygggcaetd

Timeline for d5rhma1:

• d5rhma1 first appeared in SCOPe 2.07