![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
![]() | Protein Cambialistic superoxide dismutase [54732] (2 species) active with either fe or mn |
![]() | Species Propionibacterium shermanii [TaxId:1752] [54733] (6 PDB entries) |
![]() | Domain d1bs3b2: 1bs3 B:87-201 [38748] Other proteins in same PDB: d1bs3a1, d1bs3b1 complexed with f, fe |
PDB Entry: 1bs3 (more details), 1.55 Å
SCOPe Domain Sequences for d1bs3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bs3b2 d.44.1.1 (B:87-201) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]} saperptdelgaaideffgsfdnmkaqftaaatgiqgsgwaslvwdplgkrintlqfydh qnnlpagsipllqldmwehafylqyknvkgdyvkswwnvvnwddvalrfsearva
Timeline for d1bs3b2: