Lineage for d1bs3a2 (1bs3 A:87-201)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79570Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
  4. 79571Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 79572Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 79573Protein Cambialistic superoxide dismutase [54732] (2 species)
  7. 79579Species Propionibacterium shermanii [TaxId:1752] [54733] (6 PDB entries)
  8. 79584Domain d1bs3a2: 1bs3 A:87-201 [38747]
    Other proteins in same PDB: d1bs3a1, d1bs3b1

Details for d1bs3a2

PDB Entry: 1bs3 (more details), 1.55 Å

PDB Description: p.shermanii sod(fe+3) fluoride

SCOP Domain Sequences for d1bs3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bs3a2 d.44.1.1 (A:87-201) Cambialistic superoxide dismutase {Propionibacterium shermanii}
saperptdelgaaideffgsfdnmkaqftaaatgiqgsgwaslvwdplgkrintlqfydh
qnnlpagsipllqldmwehafylqyknvkgdyvkswwnvvnwddvalrfsearva

SCOP Domain Coordinates for d1bs3a2:

Click to download the PDB-style file with coordinates for d1bs3a2.
(The format of our PDB-style files is described here.)

Timeline for d1bs3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bs3a1