Lineage for d5r00a1 (5r00 A:1836-2069)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. Family c.55.3.14: Prp8 beta-finger domain-like [159638] (1 protein)
    automatically mapped to Pfam PF12134
  6. Protein Pre-mRNA splicing factor 8, Prp8 / Spp42 [159639] (4 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [234880] (138 PDB entries)
  8. Domain d5r00a1: 5r00 A:1836-2069 [387467]
    Other proteins in same PDB: d5r00a2, d5r00b1, d5r00b2
    automated match to d3e9la1

Details for d5r00a1

PDB Entry: 5r00 (more details), 1.7200000000000002 Å

PDB Description: pandda analysis group deposition -- auto-refined data of aar2/rnaseh for ground state model 51
PDB Compounds: (A:) Pre-mRNA-splicing factor 8

SCOPe Domain Sequences for d5r00a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5r00a1 c.55.3.14 (A:1836-2069) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflkiih
tsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfpnia
irptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlllral
ktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynv

SCOPe Domain Coordinates for d5r00a1 are not available.

Timeline for d5r00a1:

Domains from same chain:
(mouse over for more information)
d5r00a2
Domains from other chains:
(mouse over for more information)
d5r00b1, d5r00b2