SCOPe 2.08: Domain d5rhxa2: 5rhx A:482-617

Lineage for d5rhxa2 (5rhx A:482-617)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [317810] (28 PDB entries)

8. Domain d5rhxa2: 5rhx A:482-617 [387457]
   Other proteins in same PDB: d5rhxa1
   automated match to d5y4za2
   complexed with edo, mpd, po4, ur1

Details for d5rhxa2

PDB Entry: 5rhx, 1.73 Å

PDB Description: pandda analysis group deposition -- crystal structure of zika virus ns3 helicase in complex with z1324080698

PDB Compounds: (A:) NS3 helicase

SCOPe Domain Sequences for d5rhxa2:

Sequence; same for both SEQRES and ATOM records:

>d5rhxa2 c.37.1.0 (A:482-617) automated matches {Zika virus [TaxId: 64320]}
eghahwlearmlldniylqdgliaslyrpeadkvaaiegefklrteqrktfvelmkrgdl
pvwlayqvasagitytdrrwcfdgttnntimedsvpaevwtkygekrvlkprwmdarvcs
dhaalksfkefaagkr

Timeline for d5rhxa2:

• d5rhxa2 first appeared in SCOPe 2.07