Lineage for d5qyha1 (5qyh A:1836-2086)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. Family c.55.3.14: Prp8 beta-finger domain-like [159638] (1 protein)
    automatically mapped to Pfam PF12134
  6. Protein Pre-mRNA splicing factor 8, Prp8 / Spp42 [159639] (4 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [234880] (138 PDB entries)
  8. Domain d5qyha1: 5qyh A:1836-2086 [387430]
    Other proteins in same PDB: d5qyha2, d5qyhb1, d5qyhb2
    automated match to d3e9la1
    complexed with pgr, so4, t9v

Details for d5qyha1

PDB Entry: 5qyh (more details), 1.47 Å

PDB Description: pandda analysis group deposition -- aar2/rnaseh in complex with fragment f2x-entry g04a
PDB Compounds: (A:) Pre-mRNA-splicing factor 8

SCOPe Domain Sequences for d5qyha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qyha1 c.55.3.14 (A:1836-2086) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflkiih
tsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfpnia
irptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlllral
ktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnisalt
qteikdiilgq

SCOPe Domain Coordinates for d5qyha1 are not available.

Timeline for d5qyha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5qyha2
View in 3D
Domains from other chains:
(mouse over for more information)
d5qyhb1, d5qyhb2