Lineage for d1b06e2 (1b06 E:93-210)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903583Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1903584Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1903585Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 1903613Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)
  7. 1903696Species Sulfolobus acidocaldarius [TaxId:2285] [54731] (1 PDB entry)
  8. 1903701Domain d1b06e2: 1b06 E:93-210 [38741]
    Other proteins in same PDB: d1b06a1, d1b06b1, d1b06c1, d1b06d1, d1b06e1, d1b06f1
    complexed with fe

Details for d1b06e2

PDB Entry: 1b06 (more details), 2.2 Å

PDB Description: superoxide dismutase from sulfolobus acidocaldarius
PDB Compounds: (E:) protein (superoxide dismutase)

SCOPe Domain Sequences for d1b06e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b06e2 d.44.1.1 (E:93-210) Fe superoxide dismutase (FeSOD) {Sulfolobus acidocaldarius [TaxId: 2285]}
pagkgggkpggaladlidkqygsfdrfkqvfsesanslpgsgwtvlyydnesgnlqimtv
enhfmnhiaelpvilivdefehayylqyknkrgdylnawwnvvnwddaekrlqkylnk

SCOPe Domain Coordinates for d1b06e2:

Click to download the PDB-style file with coordinates for d1b06e2.
(The format of our PDB-style files is described here.)

Timeline for d1b06e2: