SCOP 1.73: Domain d1b06e2: 1b06 E:93-210

Lineage for d1b06e2 (1b06 E:93-210)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)

7. Species Archaeon Sulfolobus acidocaldarius [TaxId:2285] [54731] (1 PDB entry)

8. Domain d1b06e2: 1b06 E:93-210 [38741]
   Other proteins in same PDB: d1b06a1, d1b06b1, d1b06c1, d1b06d1, d1b06e1, d1b06f1

Details for d1b06e2

PDB Entry: 1b06, 2.2 Å

PDB Description: superoxide dismutase from sulfolobus acidocaldarius

PDB Compounds: (E:) protein (superoxide dismutase)

SCOP Domain Sequences for d1b06e2:

Sequence; same for both SEQRES and ATOM records:

>d1b06e2 d.44.1.1 (E:93-210) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}
pagkgggkpggaladlidkqygsfdrfkqvfsesanslpgsgwtvlyydnesgnlqimtv
enhfmnhiaelpvilivdefehayylqyknkrgdylnawwnvvnwddaekrlqkylnk

Timeline for d1b06e2:

• d1b06e2 first appeared (with stable ids) in SCOP 1.55
  
• d1b06e2 appears in SCOP 1.71
  
• d1b06e2 appears in SCOP 1.75
  
• d1b06e2 appears in the current release, SCOPe 2.08