Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) |
Protein Fe superoxide dismutase (FeSOD) [54725] (10 species) |
Species Archaeon Sulfolobus acidocaldarius [TaxId:2285] [54731] (1 PDB entry) |
Domain d1b06e2: 1b06 E:93-210 [38741] Other proteins in same PDB: d1b06a1, d1b06b1, d1b06c1, d1b06d1, d1b06e1, d1b06f1 |
PDB Entry: 1b06 (more details), 2.2 Å
SCOP Domain Sequences for d1b06e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b06e2 d.44.1.1 (E:93-210) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} pagkgggkpggaladlidkqygsfdrfkqvfsesanslpgsgwtvlyydnesgnlqimtv enhfmnhiaelpvilivdefehayylqyknkrgdylnawwnvvnwddaekrlqkylnk
Timeline for d1b06e2: