![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
![]() | Protein Fe superoxide dismutase (FeSOD) [54725] (10 species) |
![]() | Species Sulfolobus acidocaldarius [TaxId:2285] [54731] (1 PDB entry) |
![]() | Domain d1b06c2: 1b06 C:93-210 [38739] Other proteins in same PDB: d1b06a1, d1b06b1, d1b06c1, d1b06d1, d1b06e1, d1b06f1 complexed with fe |
PDB Entry: 1b06 (more details), 2.2 Å
SCOPe Domain Sequences for d1b06c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b06c2 d.44.1.1 (C:93-210) Fe superoxide dismutase (FeSOD) {Sulfolobus acidocaldarius [TaxId: 2285]} pagkgggkpggaladlidkqygsfdrfkqvfsesanslpgsgwtvlyydnesgnlqimtv enhfmnhiaelpvilivdefehayylqyknkrgdylnawwnvvnwddaekrlqkylnk
Timeline for d1b06c2: