Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) consists of one domain of this fold |
Family c.55.3.14: Prp8 beta-finger domain-like [159638] (1 protein) automatically mapped to Pfam PF12134 |
Protein Pre-mRNA splicing factor 8, Prp8 / Spp42 [159639] (4 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [234880] (138 PDB entries) |
Domain d5qyxa1: 5qyx A:1836-2069 [387362] Other proteins in same PDB: d5qyxa2, d5qyxb1, d5qyxb2 automated match to d3e9la1 |
PDB Entry: 5qyx (more details), 1.6 Å
SCOPe Domain Sequences for d5qyxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5qyxa1 c.55.3.14 (A:1836-2069) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} nssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflkiih tsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfpnia irptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlllral ktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynv
Timeline for d5qyxa1: