Lineage for d1sssa2 (1sss A:93-208)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79570Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
  4. 79571Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 79572Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 79592Protein Fe superoxide dismutase (FeSOD) [54725] (6 species)
  7. 79602Species Archaeon Sulfolobus solfataricus [TaxId:2287] [54730] (1 PDB entry)
  8. 79603Domain d1sssa2: 1sss A:93-208 [38735]
    Other proteins in same PDB: d1sssa1, d1sssb1

Details for d1sssa2

PDB Entry: 1sss (more details), 2.3 Å

PDB Description: iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. 2.3 a resolution structure of recombinant protein with a covalently modified tyrosin in the active site.

SCOP Domain Sequences for d1sssa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sssa2 d.44.1.1 (A:93-208) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus}
psgkgggkpggaladlinkqygsfdrfkqvftetanslpgtgwavlyydtesgnlqimtf
enhfqnhiaeipiilildefehayylqyknkradyvnawwnvvnwdaaekklqkyl

SCOP Domain Coordinates for d1sssa2:

Click to download the PDB-style file with coordinates for d1sssa2.
(The format of our PDB-style files is described here.)

Timeline for d1sssa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sssa1