SCOPe 2.07: Domain d6k79c2: 6k79 C:248-491

Lineage for d6k79c2 (6k79 C:248-491)

Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
duplication contains two domains of this fold
Family c.55.1.0: automated matches [227137] (1 protein)
not a true family
Protein automated matches [226839] (63 species)
not a true protein
Species Thermococcus kodakarensis [TaxId:69014] [225454] (4 PDB entries)
Domain d6k79c2: 6k79 C:248-491 [387343]
automated match to d2zf5o2
complexed with gol, pge

Details for d6k79c2

PDB Entry: 6k79 (more details), 2.19 Å

PDB Description: glycerol kinase form thermococcus kodakarensis, complex structure with substrate.

PDB Compounds: (C:) glycerol kinase

SCOPe Domain Sequences for d6k79c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k79c2 c.55.1.0 (C:248-491) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
aafeagmvkatygtgsfilvntdemvlysdnllttiawglngrvsyalegsifvtgaavq
wlrdgikiikhaseteelatklesnegvyfvpafvglgapywdqfargiiigitrgtgre
hlaratleaiayltrdvvdemeklvqikelrvdggatandflmqfqadilnrkvirpvvk
ettalgaaylaglavdywadtreiaelwkaerifepkmdektrerlykgwkeavkramgw
akvv

SCOPe Domain Coordinates for d6k79c2:

Click to download the PDB-style file with coordinates for d6k79c2.
(The format of our PDB-style files is described here.)

Timeline for d6k79c2: