Lineage for d1coja2 (1coj A:91-212)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) 
automatically mapped to Pfam PF02777Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) 
Protein Fe superoxide dismutase (FeSOD) [54725] (10 species) 
Species Aquifex pyrophilus [TaxId:2714] [54729] (1 PDB entry) 
Domain d1coja2: 1coj A:91-212 [38734]
Other proteins in same PDB: d1coja1
complexed with fe
Details for d1coja2
PDB Entry: 1coj (more details), 1.9 Å
PDB Description: fe-sod from aquifex pyrophilus, a hyperthermophilic bacterium
PDB Compounds: (A:) protein (superoxide dismutase)SCOPe Domain Sequences for d1coja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1coja2 d.44.1.1 (A:91-212) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]}
ggkgepsealkkkieediggldactnelkaaamafrgwailgldifsgrlvvngldahnv
ynltgliplividtyehayyvdyknkrppyidaffkninwdvvnerfekamkayealkdf
ik
SCOPe Domain Coordinates for d1coja2:
Click to download the PDB-style file with coordinates for d1coja2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1coja2:
- d1coja2 first appeared (with stable ids) in SCOP 1.55
- d1coja2 appears in SCOPe 2.07
View in 3D
