SCOPe 2.07: Domain d5qy1b1: 5qy1 B:1-152

Lineage for d5qy1b1 (5qy1 B:1-152)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.182: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345889] (1 superfamily)
   10-stranded mixed beta sandwich with 3 helices surrounding the upper rim

4. Superfamily b.182.1: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345922] (1 family)
   N-terminal part of Pfam PF05282

5. Family b.182.1.1: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345967] (2 proteins)

6. Protein U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain [346065] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346269] (140 PDB entries)

8. Domain d5qy1b1: 5qy1 B:1-152 [387313]
   Other proteins in same PDB: d5qy1a1, d5qy1a2, d5qy1b2
   automated match to d3sbtb1
   complexed with pgr, r8a, so4

Details for d5qy1b1

PDB Entry: 5qy1, 1.72 Å

PDB Description: pandda analysis group deposition -- aar2/rnaseh in complex with fragment f2x-entry a07a

PDB Compounds: (B:) A1 cistron-splicing factor AAR2

SCOPe Domain Sequences for d5qy1b1:

Sequence; same for both SEQRES and ATOM records:

>d5qy1b1 b.182.1.1 (B:1-152) U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mntvpftsapievtigidqysfnvkenqpfhgikdipighvhvihfqhadnssmrygywf
dcrmgnfyiqydpkdglykmmeerdgakfenivhnfkerqmmvsypkideddtwynltef
vqmdkirkivrkdenqfsyvdssmttvqenel

Timeline for d5qy1b1:

• d5qy1b1 is new in SCOPe 2.07-stable
  
• d5qy1b1 appears in the current release, SCOPe 2.08