Lineage for d1idsb2 (1ids B:86-199)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31967Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
  4. 31968Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 31969Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 31989Protein Fe superoxide dismutase (FeSOD) [54725] (6 species)
  7. 31999Species Mycobacterium tuberculosis [TaxId:1773] [54728] (1 PDB entry)
  8. 32001Domain d1idsb2: 1ids B:86-199 [38731]
    Other proteins in same PDB: d1idsa1, d1idsb1, d1idsc1, d1idsd1

Details for d1idsb2

PDB Entry: 1ids (more details), 2 Å

PDB Description: x-ray structure analysis of the iron-dependent superoxide dismutase from mycobacterium tuberculosis at 2.0 angstroms resolutions reveals novel dimer-dimer interactions

SCOP Domain Sequences for d1idsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1idsb2 d.44.1.1 (B:86-199) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis}
nggdkptgelaaaiadafgsfdkfraqfhaaattvqgsgwaalgwdtlgnkllifqvydh
qtnfplgivplllldmwehafylqyknvkvdfakafwnvvnwadvqsryaaats

SCOP Domain Coordinates for d1idsb2:

Click to download the PDB-style file with coordinates for d1idsb2.
(The format of our PDB-style files is described here.)

Timeline for d1idsb2: