SCOPe 2.08: Domain d6p9o3_: 6p9o 3:

Lineage for d6p9o3_ (6p9o 3:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Poliovirus coat proteins [49666] (3 species)

7. Species Poliovirus type 1, strain Mahoney [TaxId:12080] [49667] (13 PDB entries)

8. Domain d6p9o3_: 6p9o 3: [387301]
   automated match to d1pov3_

Details for d6p9o3_

PDB Entry: 6p9o, 2.9 Å

PDB Description: poliovirus 135s-like expanded particle in complex with a monoclonal antibody directed against the n-terminal extension of capsid protein vp1

PDB Compounds: (3:) vp3

SCOPe Domain Sequences for d6p9o3_:

Sequence, based on SEQRES records:

>d6p9o3_ b.121.4.1 (3:) Poliovirus coat proteins {Poliovirus type 1, strain Mahoney [TaxId: 12080]}
glpvmntpgsnqyltadnfqspcalpefdvtppidipgevknmmelaeidtmipfdlsat
kkntmemyrvrlsdkphtddpilclslspasdprlshtmlgeilnyythwagslkftflf
cgsmmatgkllvsyappgadppkkrkeamlgthviwdiglqssctmvvpwisnttyrqti
ddsfteggyisvfyqtrivvplstpremdilgfvsacndfsvrllrdtthi

Sequence, based on observed residues (ATOM records):

>d6p9o3_ b.121.4.1 (3:) Poliovirus coat proteins {Poliovirus type 1, strain Mahoney [TaxId: 12080]}
glpvmntpgsnqyltadnfqspcalpefdvtppidipgevknmmelaeidtmipfdlsat
kkntmemyrvrlsdkphtddpilclslspasdprlshtmlgeilnyythwagslkftflf
cgsmmatgkllvsyappgadppkkrkeamlgthviwdiglqssctmvvpwisnttytegg
yisvfyqtrivvplstpremdilgfvsacndfsvrllrdtthi

Timeline for d6p9o3_:

• d6p9o3_ first appeared in SCOPe 2.07