Lineage for d5qy4b2 (5qy4 B:170-317)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727612Superfamily a.118.29: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345916] (1 family) (S)
    C-terminal part of Pfam PF05282
    Structural similarity with VHS domains (48464) noted in PubMed 21764848, but no compelling evidence of homology
  5. 2727613Family a.118.29.1: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345957] (2 proteins)
  6. 2727614Protein U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain [346042] (1 species)
  7. 2727615Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346205] (140 PDB entries)
  8. 2727679Domain d5qy4b2: 5qy4 B:170-317 [387296]
    Other proteins in same PDB: d5qy4a1, d5qy4a2, d5qy4b1
    automated match to d3sbtb2
    complexed with pgr, so4, t9s

Details for d5qy4b2

PDB Entry: 5qy4 (more details), 1.57 Å

PDB Description: pandda analysis group deposition -- aar2/rnaseh in complex with fragment f2x-entry b08a
PDB Compounds: (B:) A1 cistron-splicing factor AAR2

SCOPe Domain Sequences for d5qy4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qy4b2 a.118.29.1 (B:170-317) U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sdpahslnytvinfksreairpghemedfldksyylntvmlqgifknssnyfgelqfafl
namffgnygsslqwhamielicssatvpkhmldkldeilyyqiktlpeqysdillnervw
niclyssfqknslhntekimenkypell

SCOPe Domain Coordinates for d5qy4b2:

Click to download the PDB-style file with coordinates for d5qy4b2.
(The format of our PDB-style files is described here.)

Timeline for d5qy4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5qy4b1