Lineage for d5qy4b1 (5qy4 B:1-152)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825821Fold b.182: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345889] (1 superfamily)
    10-stranded mixed beta sandwich with 3 helices surrounding the upper rim
  4. 2825822Superfamily b.182.1: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345922] (1 family) (S)
    N-terminal part of Pfam PF05282
  5. 2825823Family b.182.1.1: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345967] (2 proteins)
  6. 2825824Protein U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain [346065] (1 species)
  7. 2825825Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346269] (140 PDB entries)
  8. 2825889Domain d5qy4b1: 5qy4 B:1-152 [387295]
    Other proteins in same PDB: d5qy4a1, d5qy4a2, d5qy4b2
    automated match to d3sbtb1
    complexed with pgr, so4, t9s

Details for d5qy4b1

PDB Entry: 5qy4 (more details), 1.57 Å

PDB Description: pandda analysis group deposition -- aar2/rnaseh in complex with fragment f2x-entry b08a
PDB Compounds: (B:) A1 cistron-splicing factor AAR2

SCOPe Domain Sequences for d5qy4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qy4b1 b.182.1.1 (B:1-152) U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mntvpftsapievtigidqysfnvkenqpfhgikdipighvhvihfqhadnssmrygywf
dcrmgnfyiqydpkdglykmmeerdgakfenivhnfkerqmmvsypkideddtwynltef
vqmdkirkivrkdenqfsyvdssmttvqenel

SCOPe Domain Coordinates for d5qy4b1:

Click to download the PDB-style file with coordinates for d5qy4b1.
(The format of our PDB-style files is described here.)

Timeline for d5qy4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5qy4b2