Lineage for d1isba2 (1isb A:83-192)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31967Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
  4. 31968Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 31969Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 31989Protein Fe superoxide dismutase (FeSOD) [54725] (6 species)
  7. 31992Species Escherichia coli [TaxId:562] [54727] (3 PDB entries)
  8. 31997Domain d1isba2: 1isb A:83-192 [38728]
    Other proteins in same PDB: d1isba1, d1isbb1

Details for d1isba2

PDB Entry: 1isb (more details), 1.85 Å

PDB Description: structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus

SCOP Domain Sequences for d1isba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1isba2 d.44.1.1 (A:83-192) Fe superoxide dismutase (FeSOD) {Escherichia coli}
naggeptgkvaeaiaasfgsfadfkaqftdaaiknfgsgwtwlvknsdgklaivstsnag
tplttdatplltvdvwehayyidyrnarpgylehfwalvnwefvaknlaa

SCOP Domain Coordinates for d1isba2:

Click to download the PDB-style file with coordinates for d1isba2.
(The format of our PDB-style files is described here.)

Timeline for d1isba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1isba1