Lineage for d3sdpa2 (3sdp A:84-190)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513720Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2513721Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2513722Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 protein domains)
  6. 2513750Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)
  7. 2513798Species Pseudomonas ovalis [TaxId:303] [54726] (2 PDB entries)
  8. 2513802Domain d3sdpa2: 3sdp A:84-190 [38722]
    Other proteins in same PDB: d3sdpa1, d3sdpb1
    complexed with fe

Details for d3sdpa2

PDB Entry: 3sdp (more details), 2.1 Å

PDB Description: the 2.1 angstroms resolution structure of iron superoxide dismutase from pseudomonas ovalis
PDB Compounds: (A:) iron superoxide dismutase

SCOPe Domain Sequences for d3sdpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdpa2 d.44.1.1 (A:84-190) Fe superoxide dismutase (FeSOD) {Pseudomonas ovalis [TaxId: 303]}
daggqptgaladainaafgsfdkfkeeftktsvgtfgsgwawlvkadgslalcstigaga
pltsgdtplltcdvwehayyidyrnlrpkyveafwnlvnwafvaeeg

SCOPe Domain Coordinates for d3sdpa2:

Click to download the PDB-style file with coordinates for d3sdpa2.
(The format of our PDB-style files is described here.)

Timeline for d3sdpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3sdpa1