SCOPe 2.03: Domain d1dt0c2: 1dt0 C:84-195

Lineage for d1dt0c2 (1dt0 C:84-195)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)

7. Species Pseudomonas ovalis [TaxId:303] [54726] (2 PDB entries)

8. Domain d1dt0c2: 1dt0 C:84-195 [38721]
   Other proteins in same PDB: d1dt0a1, d1dt0b1, d1dt0c1
   complexed with fe

Details for d1dt0c2

PDB Entry: 1dt0, 2.1 Å

PDB Description: cloning, sequence, and crystallographic structure of recombinant iron superoxide dismutase from pseudomonas ovalis

PDB Compounds: (C:) superoxide dismutase

SCOPe Domain Sequences for d1dt0c2:

Sequence; same for both SEQRES and ATOM records:

>d1dt0c2 d.44.1.1 (C:84-195) Fe superoxide dismutase (FeSOD) {Pseudomonas ovalis [TaxId: 303]}
aggqptgaladainaafgsfdkfkeeftktsvgtfgsgwgwlvkkadgslalastigagc
pltigdtplltcdvwehayyidyrnlrpkyveafwnlvnwafvaeqfegkty

Timeline for d1dt0c2:

• d1dt0c2 first appeared (with stable ids) in SCOP 1.55
  
• d1dt0c2 appears in SCOPe 2.02
  
• d1dt0c2 appears in SCOPe 2.04
  
• d1dt0c2 appears in the current release, SCOPe 2.08