Lineage for d1dt0c2 (1dt0 C:84-195)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946003Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2946031Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)
  7. 2946079Species Pseudomonas ovalis [TaxId:303] [54726] (2 PDB entries)
  8. 2946082Domain d1dt0c2: 1dt0 C:84-195 [38721]
    Other proteins in same PDB: d1dt0a1, d1dt0b1, d1dt0c1
    complexed with fe

Details for d1dt0c2

PDB Entry: 1dt0 (more details), 2.1 Å

PDB Description: cloning, sequence, and crystallographic structure of recombinant iron superoxide dismutase from pseudomonas ovalis
PDB Compounds: (C:) superoxide dismutase

SCOPe Domain Sequences for d1dt0c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dt0c2 d.44.1.1 (C:84-195) Fe superoxide dismutase (FeSOD) {Pseudomonas ovalis [TaxId: 303]}
aggqptgaladainaafgsfdkfkeeftktsvgtfgsgwgwlvkkadgslalastigagc
pltigdtplltcdvwehayyidyrnlrpkyveafwnlvnwafvaeqfegkty

SCOPe Domain Coordinates for d1dt0c2:

Click to download the PDB-style file with coordinates for d1dt0c2.
(The format of our PDB-style files is described here.)

Timeline for d1dt0c2: