SCOP 1.71: Domain d1dt0b2: 1dt0 B:84-197

Lineage for d1dt0b2 (1dt0 B:84-197)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)

7. Species Pseudomonas ovalis [TaxId:303] [54726] (2 PDB entries)

8. Domain d1dt0b2: 1dt0 B:84-197 [38720]
   Other proteins in same PDB: d1dt0a1, d1dt0b1, d1dt0c1

Details for d1dt0b2

PDB Entry: 1dt0, 2.1 Å

PDB Description: cloning, sequence, and crystallographic structure of recombinant iron superoxide dismutase from pseudomonas ovalis

SCOP Domain Sequences for d1dt0b2:

Sequence; same for both SEQRES and ATOM records:

>d1dt0b2 d.44.1.1 (B:84-197) Fe superoxide dismutase (FeSOD) {Pseudomonas ovalis}
aggqptgaladainaafgsfdkfkeeftktsvgtfgsgwgwlvkkadgslalastigagc
pltigdtplltcdvwehayyidyrnlrpkyveafwnlvnwafvaeqfegktykv

Timeline for d1dt0b2:

• d1dt0b2 first appeared (with stable ids) in SCOP 1.55
  
• d1dt0b2 appears in SCOP 1.69
  
• d1dt0b2 appears in SCOP 1.73
  
• d1dt0b2 appears in the current release, SCOPe 2.08