Lineage for d5qyea1 (5qye A:1836-2086)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886992Family c.55.3.14: Prp8 beta-finger domain-like [159638] (1 protein)
    automatically mapped to Pfam PF12134
  6. 2886993Protein Pre-mRNA splicing factor 8, Prp8 / Spp42 [159639] (4 species)
  7. 2887002Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [234880] (138 PDB entries)
  8. 2887039Domain d5qyea1: 5qye A:1836-2086 [387188]
    Other proteins in same PDB: d5qyea2, d5qyeb1, d5qyeb2
    automated match to d3e9la1
    complexed with pgr, so4, usp

Details for d5qyea1

PDB Entry: 5qye (more details), 1.51 Å

PDB Description: pandda analysis group deposition -- aar2/rnaseh in complex with fragment f2x-entry e12a
PDB Compounds: (A:) Pre-mRNA-splicing factor 8

SCOPe Domain Sequences for d5qyea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qyea1 c.55.3.14 (A:1836-2086) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflkiih
tsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfpnia
irptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlllral
ktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnisalt
qteikdiilgq

SCOPe Domain Coordinates for d5qyea1:

Click to download the PDB-style file with coordinates for d5qyea1.
(The format of our PDB-style files is described here.)

Timeline for d5qyea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5qyea2