Lineage for d1msdb2 (1msd B:84-198)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31967Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
  4. 31968Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 31969Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 32020Protein Mn superoxide dismutase (MnSOD) [54721] (3 species)
  7. 32038Species Human (Homo sapiens) [TaxId:9606] [54724] (7 PDB entries)
  8. 32052Domain d1msdb2: 1msd B:84-198 [38718]
    Other proteins in same PDB: d1msda1, d1msdb1

Details for d1msdb2

PDB Entry: 1msd (more details), 3.2 Å

PDB Description: comparison of the crystal structures of genetically engineered human manganese superoxide dismutase and manganese superoxide dismutase from thermus thermophilus. differences in dimer-dimer interactions.

SCOP Domain Sequences for d1msdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1msdb2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOP Domain Coordinates for d1msdb2:

Click to download the PDB-style file with coordinates for d1msdb2.
(The format of our PDB-style files is described here.)

Timeline for d1msdb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1msdb1