Lineage for d5qyhb2 (5qyh B:170-317)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. Superfamily a.118.29: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345916] (1 family) (S)
    C-terminal part of Pfam PF05282
    Structural similarity with VHS domains (48464) noted in PubMed 21764848, but no compelling evidence of homology
  5. Family a.118.29.1: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345957] (2 proteins)
  6. Protein U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain [346042] (1 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346205] (140 PDB entries)
  8. Domain d5qyhb2: 5qyh B:170-317 [387172]
    Other proteins in same PDB: d5qyha1, d5qyha2, d5qyhb1
    automated match to d3sbtb2
    complexed with pgr, so4, t9v

Details for d5qyhb2

PDB Entry: 5qyh (more details), 1.47 Å

PDB Description: pandda analysis group deposition -- aar2/rnaseh in complex with fragment f2x-entry g04a
PDB Compounds: (B:) A1 cistron-splicing factor AAR2

SCOPe Domain Sequences for d5qyhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qyhb2 a.118.29.1 (B:170-317) U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sdpahslnytvinfksreairpghemedfldksyylntvmlqgifknssnyfgelqfafl
namffgnygsslqwhamielicssatvpkhmldkldeilyyqiktlpeqysdillnervw
niclyssfqknslhntekimenkypell

SCOPe Domain Coordinates for d5qyhb2 are not available.

Timeline for d5qyhb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5qyhb1
View in 3D
Domains from other chains:
(mouse over for more information)
d5qyha1, d5qyha2