Lineage for d1varb2 (1var B:84-198)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 132817Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
  4. 132818Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 132819Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 132888Protein Mn superoxide dismutase (MnSOD) [54721] (4 species)
  7. 132923Species Human (Homo sapiens) [TaxId:9606] [54724] (8 PDB entries)
  8. 132937Domain d1varb2: 1var B:84-198 [38716]
    Other proteins in same PDB: d1vara1, d1varb1

Details for d1varb2

PDB Entry: 1var (more details), 2.5 Å

PDB Description: mitochondrial manganese superoxide dismutase variant with ile 58 replaced by thr

SCOP Domain Sequences for d1varb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1varb2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOP Domain Coordinates for d1varb2:

Click to download the PDB-style file with coordinates for d1varb2.
(The format of our PDB-style files is described here.)

Timeline for d1varb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1varb1