Lineage for d6m5mb_ (6m5m B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002759Species Saxidomus purpuratus [TaxId:311201] [366413] (3 PDB entries)
  8. 3002761Domain d6m5mb_: 6m5m B: [387146]
    automated match to d2ox8a_
    complexed with ca, nag

Details for d6m5mb_

PDB Entry: 6m5m (more details), 1.7 Å

PDB Description: spl-1 - glcnac complex
PDB Compounds: (B:) N-acetylglucosamine-specific lectin

SCOPe Domain Sequences for d6m5mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m5mb_ d.169.1.0 (B:) automated matches {Saxidomus purpuratus [TaxId: 311201]}
ccseddcpsgwkffggscylfdegsrgwegskafceskdaslvtvecskeddfirgilsg
qtakhyywigarwneehndyrwidgspftfigwgpgkpdnnkgcldylnykevvwqwndh
vdcentngpciceidcs

SCOPe Domain Coordinates for d6m5mb_:

Click to download the PDB-style file with coordinates for d6m5mb_.
(The format of our PDB-style files is described here.)

Timeline for d6m5mb_: