SCOPe 2.08: Domain d6m5ma_: 6m5m A:

Lineage for d6m5ma_ (6m5m A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (21 species)
   not a true protein

7. Species Saxidomus purpuratus [TaxId:311201] [366413] (3 PDB entries)

8. Domain d6m5ma_: 6m5m A: [387142]
   automated match to d2bpdb_
   complexed with ca, nag

Details for d6m5ma_

PDB Entry: 6m5m, 1.7 Å

PDB Description: spl-1 - glcnac complex

PDB Compounds: (A:) N-acetylglucosamine-specific lectin

SCOPe Domain Sequences for d6m5ma_:

Sequence; same for both SEQRES and ATOM records:

>d6m5ma_ d.169.1.0 (A:) automated matches {Saxidomus purpuratus [TaxId: 311201]}
cckcdcqsgwewfggscylfdetergwedsktfcesqnaalvtvesseeddfirgvisaq
safhyywiggswdaehseyrwidgssisfngwgpnrpdadegcmdylnykeivwqwndhq
dcvntkgpsicetdcs

Timeline for d6m5ma_:

• d6m5ma_ first appeared in SCOPe 2.07