Lineage for d1qnmb2 (1qnm B:84-198)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191397Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
  4. 191398Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 191399Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 191475Protein Mn superoxide dismutase (MnSOD) [54721] (6 species)
  7. 191515Species Human (Homo sapiens) [TaxId:9606] [54724] (11 PDB entries)
  8. 191531Domain d1qnmb2: 1qnm B:84-198 [38714]
    Other proteins in same PDB: d1qnma1, d1qnmb1

Details for d1qnmb2

PDB Entry: 1qnm (more details), 2.3 Å

PDB Description: human manganese superoxide dismutase mutant q143n

SCOP Domain Sequences for d1qnmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnmb2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnn
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOP Domain Coordinates for d1qnmb2:

Click to download the PDB-style file with coordinates for d1qnmb2.
(The format of our PDB-style files is described here.)

Timeline for d1qnmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qnmb1