Lineage for d6k79a1 (6k79 A:2-247)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885622Species Thermococcus kodakarensis [TaxId:69014] [225454] (4 PDB entries)
  8. 2885627Domain d6k79a1: 6k79 A:2-247 [387130]
    automated match to d2zf5o1
    complexed with gol, pge

Details for d6k79a1

PDB Entry: 6k79 (more details), 2.19 Å

PDB Description: glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
PDB Compounds: (A:) glycerol kinase

SCOPe Domain Sequences for d6k79a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k79a1 c.55.1.0 (A:2-247) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
ekfvlsldegttsaraiifdresnihgigqyefpqhyprpgwvehnpeeiwdaqlraikd
aiqsariepnqiaaigvtnqrettlvwdkdgkplynaivwqcrrtaemveeikreygtmi
kektglvpdayfsasklkwlldnvpglrekaekgevmfgtvdtfliyrltgehvtdysna
srtmlfnikkldwddellelfdipesvlpevressevygytkkellgaeipvsgdagdqq
aalfgq

SCOPe Domain Coordinates for d6k79a1:

Click to download the PDB-style file with coordinates for d6k79a1.
(The format of our PDB-style files is described here.)

Timeline for d6k79a1: